Instagram story viewer> @boworldwide> Tagged
Box Office Worldwide(@boworldwide)'s profile avatar HD Profile

Box Office Worldwide

@boworldwide

5.2K
followers
54
following
Latest updates on movies and box office collections!
POSTS STORIES REELS TAGGED
#instagood #viral #reels #instagram #trending
5
Download
Jailer 2 shocking advance booking ? 😮 #jailer2 #rajnikanth #boxofficecollections #advancebooking
11
Download
MASS CELEBRATIONS BY AKOLA FC!! 🔥🧨💥🔥 @ajaydevgn 🙇🏻❤️‍🔥 #DrishyamTheConclusion #Drishyam3 #drishyam3 #drishyam_media_news_payyurkkavu__gramamviral @aamilkeeyankhan @paragdesai9 @tabutiful @ishidutta @abhishekpathakk @panorama_studios @devgnfilms
26
Download
@billboard @billboardcharts @number.1fm
0
Download
🔥 BOX OFFICE REPORT | MIRZAPUR: THE MOVIE 🔥 The power struggle of Mirzapur has arrived on the big screen, bringing back the characters, rivalries and ruthless battle for control that made the franchise a fan favourite. 🎬⚔️ 📊 BOX OFFICE BREAKDOWN 💰 Day 1: ₹25.75 Cr 💰 Day 2: ₹32.00 Cr 💰 Day 3: ₹36.00 Cr 💰 Day 4: ₹16.00 Cr 💰 Day 5: ₹15.60 Cr 💰 Day 6: ₹9.26 Cr 🇮🇳 India Net: ₹134.61 Cr 🌍 Worldwide Gross: ₹176+ Cr (Approx.) 💵 Reported Budget: ₹80 Cr ⭐ IMDb: 8.1/10 🎭 Genre: Action | Crime | Thriller | Gangster Drama 🎬 SYNOPSIS Mirzapur: The Movie takes the story into a bigger cinematic chapter, where the fight for power becomes even more dangerous. Old enemies, shifting loyalties, revenge and ambition collide as contenders battle for control of Mirzapur’s violent underworld. With power, betrayal and revenge driving the story, the film brings the intense world of Mirzapur to the big screen. 🔥 💬 Now it’s your turn! ⭐ Rate Mirzapur: The Movie out of 10. What rating would you give it? ❤️ Like | 💬 Comment | 🔄 Share 👉 Follow @cinesutramedia for the latest Box Office collections, movie news, reviews, ratings, entertainment updates & exclusive cinema content! 🎥🍿 #bollywood #cinesutramedia #boxoffice #mirzapurthemovie #pankajtripathi
6
Download
#MegaBreakingNews: VAMSHI PAIDIPALLY'S's Direction, DILRAJU'S film, ANIRUDH'S BGM, The Action Sequences Directed by a 'Korean action team', & Megastar #SALMANKHAN's Never-Before-Seen Bloody Action Avatar, The TEASER of SALMAN KHAN'S film 'MONSTER' opens with rain, blood, and a shirtless bald head; -The Teaser has been designed as a dark, high-impact title reveal. The teaser is expected to release soon. -The Teaser is expected to present Salman in an intense and stripped-down action avatar. The visual mood is understood to be grim and violent, opening in the middle of rain-soaked devastation. Salman appears bare-chested and bald in the teaser, instantly setting a more brutal tone than a conventional hero entry. -The imagery gets darker from there. Dead bodies are seen lying around him, with blood adding to the film’s raw atmosphere. At one key moment, Salman is shown sitting on the ground before taking out a knife, a beat that appears to be designed as the teaser’s most striking image. The sequence then moves toward the title reveal of Monster, positioning the film as a gritty action spectacle rather than a sleek star vehicle. -The music is being composed by Vishal Mishra, who is also set to sing the title track. The film is currently in production with schedules filming in Mumbai and massive sets including an Afghanistan village recreation. -Megastar Salman Khan is performing intense stunts himself. #monster In Cinemas Worldwide Releasing On Eid 2027. #salmankhanvamshipaidipallyfilm @beingsalmankhan @nayanthara @directorvamshi @srivenkateswaracreations @anirudhofficial @vishalmishraofficial @rahuldevofficial @anilskapoor
0
Download
The streets have a new announcement… 👑 KING is now on the move, taking the hype across the city. Every turn. Every corner. One name. #KING 🔥 24.12.2026 @iamsrk @iamsrkclubofficial @poojadadlani02 @karuna_badwal @bellamul89 #srkssoldiers #srk #ShahRukhKhan #srkfanclub
6
Download
❤️ 20 YEARS OF KABHI ALVIDA NA KEHNA ❤️ Some love stories don’t end… they stay with you forever. 🥹✨ Dev & Maya — a love that was complicated, imperfect, and unforgettable. ❤️‍🩹 20 years later, their story still hits differently. 🎬🫶🏻 20 YEARS. ONE LOVE STORY. ENDLESS EMOTIONS. ❤️ #20YearsOfKANK #KabhiAlvidaNaKehna #KANK #DevAndMaya #ShahRukhKhan
3
Download
Box Office Breakdown: Jana Nayagan (First 3 Days) 💥 Thalapathy Vijay’s much-awaited farewell film has had a mixed start at the box office. After a blockbuster opening of ₹42.70 Cr, the film witnessed a sharp drop on Day 2 but bounced back with strong growth on Day 3. 📊 First 3 Days Collection: 🔥 Day 1: ₹42.70 Cr (India Net) 📉 Day 2: ₹21.15 Cr (India Net) 📈 Day 3: ₹28.50 Cr (India Net) 💰 Total India Net: ₹92.35 Cr 🌍 Worldwide Gross: ₹171.84+ Cr 🎬 Budget: ₹350 Cr ⭐ IMDb Rating: 5.8/10 🤔 Do you think Jana Nayagan will recover its massive budget and become a HIT, or is it heading towards FLOP status? 👇 Share your prediction in the comments! ❤️ Follow @cinesutramedia for the latest box office updates, movie reviews, exclusive entertainment news, and daily cinema content! 🎥 #cinesutramedia #bollywood #jananayagan❤️‍🔥 #vijay #boxoffice
97
Download
#LATEST: Latest Pic Of Megastar #SalmanKhan From The Sets of #SVC63! -The Picture of Megastar @beingsalmankhan Uploaded by his Coach. -IT'S THE CALM BEFORE THE STORM, -THE BIGGEST COMEBACK IN INDIAN CINEMA IS LOADING. -The Title Announcement is on the way. @directorvamshi @srivenkateswaracreations @nayanthara #SALMANKHANVAMSHIPAIDIPALLYFILM #Eid2027
0
Download
#Exlusive: Megastar #SalmanKhan and #Nayanthara film is Tentatively Titled #TheMessanger. #SVC63 @dainikbhaskar @beingsalmankhan @nayanthara Direct @directorvamshi Producer: Dil Raju, @Shirish, @srivenkateswaracreations @kuldeep_rathore18 @RafiKazi Salma Khan Vamshi Paidipally Film On EiD 2027.
0
Download
#MEGAXLUSIVE: Megastar #SalmanKhan's first Superhero film with Direct #RajandDK Will Go on floors in October 2026. #Samantha is not part of the film. -This High-Concept Action Entertainer Project will be Produced by @atulreellife and talks are underway with South's @mythriofficial Production. -The Makers are Currently in the Pre-Production stage, locking the scale, look, and technical aspects of the film. -It’s a Big-Budget Superhero film Designed for a Global Audience. -The film is Scheduled to Release in the Second half of 2027. @beingsalmankhan @samantharuthprabhuoffl @rajanddk @pinkvilla
2
Download
back to up